Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96CW6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-28 (13) SAEPAEALVLACK PA
0
32-41 (10) SDAVESAAQK PA
0
49-73 (25) AAENNVFHLVATVCSQEEPVQPLLR PA
0
111-157 (47) SLGTTSSGQESEYTPGNPEAAGNSGFQLLDLVHEEGEPEAASAGSCK PA
0
158-173 (16) TSDPDVILCNSVELIR PA
0
176-186 (11) LTVSEDGPGVR PA
0
193-250 (58) HDDYVYDIYYLETATPGWIENILSVQPYSQEWELVNDDQEPEDIYDDEDDENSENNWR PA
0
251-266 (16) NEYPEEESSDGDEDSR PA
0
267-279 (13) GSADYNSLSEEER PA
0
297-309 (13) EFGYDSPHDLDSD PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center