Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96D53-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-33 (23) GTGGQLGQTVGWPCGALGPGPHR PA
1
34-44 (11) WGPCGGSWAQK PA
1
45-52 (8) FYQDGPGR PA
1
53-60 (8) GLGEEDIR PA
1
70-78 (9) TPRPQLSDR PA
1
92-112 (21) LANFGGLAVGLGLGVLAEMAK PA
1
120-141 (22) LQSEGGSGLDSSPFLSEANAER PA
0
142-150 (9) IVQTLCTVR PA
0
156-178 (23) VGQMLSIQDNSFISPQLQHIFER PA
0
181-188 (8) QSADFMPR PA
1
194-201 (8) VLEEELGR PA
1
207-229 (23) VASLEEVPFAAASIGQVHQGLLR PA
1
230-237 (8) DGTEVAVK PA
1
238-259 (22) IQYPGIAQSIQSDVQNLLAVLK PA
1
260-288 (29) MSAALPAGLFAEQSLQALQQELAWECDYR PA
1
290-298 (9) EAACAQNFR PA
1
299-308 (10) QLLANDPFFR PA
1
321-343 (23) VLGMELAGGVPLDQCQGLSQDLR PA
1
344-356 (13) NQICFQLLTLCLR PA
1
363-391 (29) FMQTDPNWANFLYDASSHQVTLLDFGASR PA
1
392-406 (15) EFGTEFTDHYIEVVK PA
1
425-432 (8) FLTGFETK PA
1
433-464 (32) AFSDAHVEAVMILGEPFATQGPYDFGSGETAR PA
1
466-475 (10) IQDLIPVLLR PA
1
478-490 (13) LCPPPEETYALHR PA
1
492-503 (12) LAGAFLACAHLR PA
1
510-518 (9) DLFQDTYHR PA
1
524-536 (13) QPDAATAGSLPTK PA
1
537-544 (8) GDSWVDPS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center