Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96D53-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-33 (23) GTGGQLGQTVGWPCGALGPGPHR PA
1
34-44 (11) WGPCGGSWAQK PA
1
45-52 (8) FYQDGPGR PA
1
53-60 (8) GLGEEDIR PA
1
70-78 (9) TPRPQLSDR PA
1
92-112 (21) LANFGGLAVGLGLGVLAEMAK PA
1
120-137 (18) LQSDNSFISPQLQHIFER PA
0
140-147 (8) QSADFMPR PA
1
153-160 (8) VLEEELGR PA
1
166-188 (23) VASLEEVPFAAASIGQVHQGLLR PA
1
189-196 (8) DGTEVAVK PA
1
197-218 (22) IQYPGIAQSIQSDVQNLLAVLK PA
1
219-247 (29) MSAALPAGLFAEQSLQALQQELAWECDYR PA
1
249-257 (9) EAACAQNFR PA
1
258-267 (10) QLLANDPFFR PA
1
280-302 (23) VLGMELAGGVPLDQCQGLSQDLR PA
1
303-315 (13) NQICFQLLTLCLR PA
1
322-350 (29) FMQTDPNWANFLYDASSHQVTLLDFGASR PA
1
351-365 (15) EFGTEFTDHYIEVVK PA
1
384-391 (8) FLTGFETK PA
1
392-423 (32) AFSDAHVEAVMILGEPFATQGPYDFGSGETAR PA
1
425-434 (10) IQDLIPVLLR PA
1
437-449 (13) LCPPPEETYALHR PA
1
451-462 (12) LAGAFLACAHLR PA
1
469-477 (9) DLFQDTYHR PA
1
483-495 (13) QPDAATAGSLPTK PA
1
496-503 (8) GDSWVDPS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center