Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96EE3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-25 (13) DLIHDVSFDFHGR PA
1
27-37 (11) MATCSSDQSVK PA
1
42-54 (13) SESGDWHCTASWK PA
1
55-62 (8) THSGSVWR PA
1
63-81 (19) VTWAHPEFGQVLASCSFDR PA
1
82-96 (15) TAAVWEEIVGESNDK PA
1
125-140 (16) HMGLMLATCSADGIVR PA
1
141-162 (22) IYEAPDVMNLSQWSLQHEISCK PA
1
163-176 (14) LSCSCISWNPSSSR PA
1
177-196 (20) AHSPMIAVGSDDSSPNAMAK PA
1
197-207 (11) VQIFEYNENTR PA
1
212-233 (22) AETLMTVTDPVHDIAFAPNLGR PA
1
234-243 (10) SFHILAIATK PA
1
247-254 (8) IFTLKPVR PA
1
256-265 (10) ELTSSGGPTK PA
1
266-283 (18) FEIHIVAQFDNHNSQVWR PA
1
284-303 (20) VSWNITGTVLASSGDDGCVR PA
1
307-314 (8) ANYMDNWK PA
1
321-357 (37) GNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGR PA
1
358-367 (10) YFFTPLDSPR PA
0
372-404 (33) WSSYAQLLPPPPPPLVEHSCDADTANLQYPHPR PA
0
407-421 (15) YLSRPLNPLPENEGI PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center