Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96EV2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MAAALGASGGAGAGDDDFDQFDKPGAER PA
1
34-56 (23) AADEDWDSELEDDLLGEDLLSGK PA
1
58-131 (74) NQSDLSDEELNDDLLQSDNEDEENFSSQGVTISLNATSGMVTSFELSDNTNDQSGEQESEYEQEQGEDELVYHK PA
1
132-199 (68) SDGSELYTQEYPEEGQYEGHEAELTEDQIEYVEEPEEEQLYTDEVLDIEINEPLDEFTGGMETLELQK PA
1
203-217 (15) EESDEEEEDDEESGR PA
1
241-268 (28) NIPETLGNFFACLPSSFTLISTSSIVLL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center