Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96F83-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-25 (20) ELGGEPLSDLQEEAASASLR PA
0
31-39 (9) LSDDSLEWR PA
0
41-51 (11) TCPDLLLSDGK PA
0
59-67 (9) EGGSTCTAR PA
0
68-85 (18) CPDPGEHSSTWGEFEGFR PA
0
91-111 (21) SGQFSQSLELLEGPTEPQPPR PA
0
118-151 (34) ECSSHQPCQGGPWVTGTSAVPPSEPILSYENILK PA
0
152-185 (34) CAFQEITVQQAAEDVSTIDHFLEISSEEKPGVER PA
0
199-211 (13) ALQSIHTTSTSQR PA
0
218-233 (16) CQENFFLVLGIDAAQK PA
0
234-249 (16) NLSGGQGHIMEDCDLK PA
0
250-266 (17) EPEGLLTVSSFCLQHCK PA
0
273-280 (8) LSGPPGSK PA
0
293-306 (14) TPSCGGGQHITIPR PA
0
317-325 (9) LTLFNSDVC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center