Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96HD9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MCSLPVPR PA
0
14-32 (19) VAVTGGTHGNEMSGVYLAR PA
0
33-43 (11) HWLHAPAELQR PA
0
44-62 (19) ASFSAVPVLANPAATSGCR PA
0
64-71 (8) YVDHDLNR PA
0
72-92 (21) TFTSSFLNSRPTPDDPYEVTR PA
0
95-103 (9) ELNQLLGPK PA
0
104-129 (26) ASGQAFDFVLDLHNTTANMGTCLIAK PA
0
130-141 (12) SSHEVFAMHLCR PA
0
142-159 (18) HLQLQYPELSCQVFLYQR PA
0
160-172 (13) SGEESYNLDSVAK PA
0
173-188 (16) NGLGLELGPQPQGVLR PA
0
197-233 (37) TLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPR PA
0
234-250 (17) TEAGHLAGTVHPQLQDR PA
0
251-291 (41) DFQPLQPGAPIFQMFSGEDLLYEGESTVYPVFINEAAYYEK PA
0
292-300 (9) GVAFVQTEK PA
0
301-319 (19) FTFTVPAMPALTPAPSPAS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center