Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96I13-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-42 (42) MLTGVTDGIFCCLLGTPPNAVGPLESVESSDGYTFVEVKPGR PA
0
48-77 (30) HAGPAPAAAPPPPSSASSDAAQGDLSGLVR PA
0
90-97 (8) LLVENLGR PA
0
101-130 (30) ADLLHGQNGSGEPPAALEVELADPAGSDGR PA
0
131-147 (17) LAPGSAGSGSGSGSGGR PA
0
157-164 (8) TIHIDCEK PA
0
171-192 (22) GAQADVVLFFIHGVGGSLAIWK PA
0
193-200 (8) EQLDFFVR PA
0
201-235 (35) LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMR PA
0
246-271 (26) NVLIGHSYGVSFCTFLAHEYPDLVHK PA
0
272-311 (40) VIMINGGGPTALEPSFCSIFNMPTCVLHCLSPCLAWSFLK PA
0
327-339 (13) EGNAFNVSSFVLR PA
0
340-371 (32) AMMSGQYWPEGDEVYHAELTVPVLLVHGMHDK PA
0
372-380 (9) FVPVEEDQR PA
0
381-391 (11) MAEILLLAFLK PA
0
392-425 (34) LIDEGSHMVMLECPETVNTLLHEFLLWEPEPSPK PA
0
426-438 (13) ALPEPLPAPPEDK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center