Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96II8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-47 (47) MAAAGLVAVAAAAEYSGTVASGGNLPGVHCGPSSGAGPGFGPGSWSR PA
3
52-67 (16) ALEEAAVTGVLSLSGR PA
3
75-86 (12) GAANHDLTDTTR PA
3
94-118 (25) LSEIPIEACHFVSLENLNLYQNCIR PA
3
119-137 (19) YIPEAILNLQALTFLNISR PA
3
138-153 (16) NQLSTLPVHLCNLPLK PA
3
154-161 (8) VLIASNNK PA
6
162-173 (12) LVSLPEEIGHLR PA
3
174-199 (26) HLMELDVSCNEIQTIPSQIGNLEALR PA
3
206-222 (17) NHLVHLPEELAELPLIR PA
3
230-238 (9) ITTIPVCYR PA
3
242-263 (22) HLQTITLDNNPLQSPPAQICIK PA
3
271-278 (8) YLNIQACK PA
3
279-288 (10) IAPDLPDYDR PA
3
289-321 (33) RPLGFGSCHEELYSSRPYGALDSGFNSVDSGDK PA
3
323-338 (16) WSGNEPTDEFSDLPLR PA
3
351-358 (8) ESQYQENR PA
3
359-391 (33) GSLVVTNGGVEHDLDQIDYIDSCTAEEEEAEVR PA
2
395-412 (18) GPDPDSLSSQFMAYIEQR PA
2
414-427 (14) ISHEGSPVKPVAIR PA
2
444-471 (28) VPAEPSSLLSLSASHNQLSHTDLELHQR PA
3
482-494 (13) EAQLAALQYEEEK PA
3
503-510 (8) DAVLDFVK PA
3
520-536 (17) QHPLLDGVDGECPFPSR PA
3
538-572 (35) SQHTDDSALCMSLSGLNQVGCAATLPHSSAFTPLK PA
2
573-603 (31) SDDRPNALLSSPATETVHHSPAYSFPAAIQR PA
2
604-615 (12) NQPQRPESFLFR PA
3
625-650 (26) GHASPLPPSAAPTTDSTDSITGQNSR PA
3
653-663 (11) EEELELIDQLR PA
3
672-698 (27) VSLPCDLGAALTDGVVLCHLANHVRPR PA
3
699-712 (14) SVPSIHVPSPAVPK PA
2
721-730 (10) NVENFLEACR PA
5
732-749 (18) IGVPQEQLCLPLHILEEK PA
1
750-768 (19) GLSQVAVTVQALLELAPPK PA
1
769-777 (9) QQQHQLSAV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center