Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96IW7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MSMILSASVIR PA
0
14-34 (21) DGLPLSASTDYEQSTGMQECR PA
0
55-92 (38) TGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQK PA
0
93-102 (10) EFITTYNMMK PA
0
103-121 (19) TNTAVRPYCFIEFDNFIQR PA
0
136-146 (11) INLSDMQTEIK PA
0
147-173 (27) LRPPYQISMCELGSANGVTSAFSVDCK PA
0
185-209 (25) LEPATLSGIVGFILSLLCGALNLIR PA
0
210-252 (43) GFHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWR PA
0
256-274 (19) SFLTFGLICLCNMYLYELR PA
0
275-296 (22) NLWQLFFHVTVGAFVTLQIWLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center