Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96IZ5-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-24 (15) SDEHVLEELETEGER PA
2
28-46 (19) SLLQHQLDTSVSIEECMSK PA
2
48-61 (14) ESFAPGTMYKPFGK PA
2
62-78 (17) EAAGTMTLSQFQTLHEK PA
2
79-86 (8) DQETASLR PA
2
87-99 (13) ELGLNETEILIWK PA
2
112-120 (9) ATPEAIQNR PA
2
157-164 (8) SLFQGADR PA
2
170-179 (10) ALYYQDEPQK PA
1
183-199 (17) GDPMNNLESFYQEMIMK PA
2
202-209 (8) LEEFQLMR PA
2
210-239 (30) GEPFASHSLVSATSVGDSGTAESPSLLQDK PA
1
248-269 (22) GPSLHVANVIDFSPEQCWTGPK PA
1
271-285 (15) LTQPIEFVPEDEIQR PA
1
296-309 (14) IPMFSSYNPGEPNK PA
1
324-331 (8) DLVSLFAR PA
1
351-360 (10) GQAFITFPNK PA
1
361-374 (14) EIAWQALHLVNGYK PA
1
379-386 (8) ILVIEFGK PA
1
392-405 (14) SNLQATSLISCATG PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center