Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96JL9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MESVTFEDVAVEFIQEWALLDSAR PA
2
43-58 (16) GTPPCKPSCVSQLGQR PA
2
71-98 (28) ATGVAWESQLKPEELPSMQDLLEEASSR PA
2
99-109 (11) DMQMGPGLFLR PA
2
110-119 (10) MQLVPSIEER PA
2
126-144 (19) EDRPALQEPPWSLGCTGLK PA
1
152-162 (11) VVIPVPTLGHR PA
1
176-184 (9) DPAWLQEDK PA
1
185-225 (41) VEEEAMAPGLPTACSQEPVTFADVAVVFTPEEWVFLDSTQR PA
1
230-237 (8) DVMLENYR PA
74
238-258 (21) NLASVADQLCKPNALSYLEER PA
1
259-266 (8) GEQWTTDR PA
1
267-299 (33) GVLSDTCAEPQCQPQEAIPSQDTFTEILSIDVK PA
1
300-308 (9) GEQPQPGEK PA
0
312-330 (19) YNELEKPFNSIEPLFQYQR PA
0
331-344 (14) IHAGEASCECQEIR PA
0
345-358 (14) NSFFQSAHLIVPEK PA
0
393-404 (12) CFDCQECGQAFK PA
0
415-429 (15) THTGEKPFECSQCGK PA
1
434-442 (9) NFNLILHQR PA
0
443-453 (11) NHTGEKPYECK PA
2
458-466 (9) AFNQPSSLR PA
0
471-485 (15) THTGEKPFECSQCGK PA
1
503-516 (14) EKPYECNQCGKPFR PA
0
517-525 (9) TSTHLNVHK PA
0
533-545 (13) LYECATCGQVLSR PA
0
555-569 (15) THTGEKPYVCQECGR PA
0
570-578 (9) AFSEPSSLR PA
0
588-597 (10) KPYACQECGR PA
0
598-610 (13) AFGQSSHLIVHVR PA
0
611-625 (15) THSAGRPYQCNQCEK PA
0
629-637 (9) HSSSLTVHK PA
0
648-665 (18) NGSLPLSMSHPYCGPLAN PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center