Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96JS3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MYEALPGPAPENEDGLVK PA
0
21-44 (24) EEDPTWEQVCNSQEGSSHTQEICR PA
0
49-66 (18) HFCYQEAHGPQEALAQLR PA
0
67-80 (14) ELCHQWLRPEMHTK PA
0
81-98 (18) EQIMELLVLEQFLTILPK PA
0
106-169 (64) TYPLESGEEAVTVLENLETGSGDTGQQASVYIQGQDMHPMVAEYQGVSLECQSLQLLPGITTLK PA
0
170-197 (28) CEPPQRPQGNPQEVSGPVPHGSAHLQEK PA
0
203-212 (10) AVVPVFNPVR PA
0
219-231 (13) TEEETAQAVAAEK PA
0
232-239 (8) WSHLSLTR PA
0
241-264 (24) NLCGNSAQETVMSLSPMTEEIVTK PA
0
272-290 (19) QETSEEMEQSGEASGKPNR PA
0
291-306 (16) ECAPQIPCSTPIATER PA
0
307-315 (9) TVAHLNTLK PA
0
318-325 (8) HPGDLWAR PA
0
326-340 (15) MHISSLEYAAGDITR PA
0
350-367 (18) VSELLQGLSFSGDSDVEK PA
0
368-378 (11) DNEPEIQPAQK PA
0
394-413 (20) DIKPNFPSWSALDSGLLNLK PA
0
417-446 (30) LNPVELFELFFDDETFNLIVNETNNYASQK PA
0
447-458 (12) NVSLEVTVQEMR PA
0
459-471 (13) CVFGVLLLSGFMR PA
0
476-490 (15) EMYWEVSDTDQNLVR PA
0
498-516 (19) FELIFSNLHFADNGHLDQK PA
0
532-547 (16) NFLLYAPLEEYYCFDK PA
0
548-565 (18) SMCECFDSDQFLNGKPIR PA
0
570-593 (24) IWCGTTTQGYLVWFEPYQEESTMK PA
0
594-617 (24) VDEDPDLGLGGNLVMNFADVLLER PA
0
618-634 (17) GQYPYHLCFDSFFTSVK PA
0
658-667 (10) CPLMNVEHMK PA
0
678-688 (11) IEENNEIILCR PA
0
689-730 (42) WYGDGIISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVK PA
0
758-779 (22) WYSILVSYMIDVAMNNAWQLHR PA
0
780-793 (14) ACNPGASLDPLDFR PA
0
795-809 (15) FVAHFYLEHNAHLSD PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center