Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96K76-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MVPGEENQLVPK PA
2
21-28 (8) QNIFDEMK PA
0
31-42 (12) FLQIENAAEEPR PA
0
43-54 (12) VLCIIQDTTNSK PA
1
60-71 (12) ITLNLPASTPVR PA
1
73-80 (8) LFEDVANK PA
1
81-110 (30) VGYINGTFDLVWGNGINTADMAPLDHTSDK PA
1
111-121 (11) SLLDANFEPGK PA
2
123-130 (8) NFLHLTDK PA
2
131-152 (22) DGEQPQILLEDSSAGEDSVHDR PA
2
160-182 (23) EGSGGSTSDYVSQSYSYSSILNK PA
2
183-213 (31) SETGYVGLVNQAMTCYLNSLLQTLFMTPEFR PA
2
219-238 (20) WEFEESEEDPVTSIPYQLQR PA
2
239-247 (9) LFVLLQTSK PA
2
250-258 (9) AIETTDVTR PA
2
259-278 (20) SFGWDSSEAWQQHDVQELCR PA
2
279-287 (9) VMFDALEQK PA
2
290-304 (15) QTEQADLINELYQGK PA
2
311-320 (10) CLECGYEGWR PA
2
321-366 (46) IDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCER PA
2
379-391 (13) FLHFPYLLTLQLK PA
2
393-402 (10) FDFDYTTMHR PA
2
409-427 (19) MTFPEELDMSTFIDVEDEK PA
2
428-474 (47) SPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEK PA
2
483-509 (27) NSLIYELFSVMVHSGSAAGGHYYACIK PA
2
510-526 (17) SFSDEQWYSFNDQHVSR PA
2
535-543 (9) THGGSSGSR PA
2
544-562 (19) GYYSSAFASSTNAYMLIYR PA
2
572-583 (12) FLEVDEYPEHIK PA
2
611-618 (8) LFCLHPTK PA
2
636-643 (8) EAVEMAYK PA
2
644-657 (14) MMDLEEVIPLDCCR PA
2
661-670 (10) YDEFHDYLER PA
2
671-688 (18) SYEGEEDTPMGLLLGGVK PA
2
689-700 (12) STYMFDLLLETR PA
2
701-717 (17) KPDQVFQSYKPGEVMVK PA
2
725-735 (11) AESVAAPITVR PA
2
736-746 (11) AYLNQTVTEFK PA
2
752-761 (10) AIHLPAETMR PA
2
792-813 (22) VFVESSETLDYQMAFADSHLWK PA
2
824-838 (15) LFVLLPEQSPVSYSK PA
2
845-858 (14) AGGDSGNVDDDCER PA
2
868-879 (12) SVEAILEESTEK PA
2
882-898 (17) SLSLQQQQDGDNGDSSK PA
2
899-915 (17) STETSDFENIESPLNER PA
2
916-924 (9) DSSASVDNR PA
2
925-943 (19) ELEQHIQTSDPENFQSEER PA
2
944-952 (9) SDSDVNNDR PA
2
953-994 (42) STSSVDSDILSSSHSSDTLCNADNAQIPLANGLDSHSITSSR PA
2
1004-1024 (21) ETWDTAEEDSGTDSEYDESGK PA
2
1027-1035 (9) GEMQYMYFK PA
2
1036-1050 (15) AEPYAADEGSGEGHK PA
2
1051-1058 (8) WLMVHVDK PA
2
1067-1081 (15) QHLEPFVGVLSSHFK PA
2
1085-1096 (12) VYASNQEFESVR PA
2
1097-1109 (13) LNETLSSFSDDNK PA
2
1127-1139 (13) VYQLLVNEQEPCK PA
2
1140-1148 (9) FLLDAVFAK PA
2
1157-1164 (8) EELIPQLR PA
2
1165-1175 (11) EQCGLELSIDR PA
2
1185-1218 (34) NPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEK PA
2
1221-1230 (10) SMSQLAVLSR PA
3
1239-1256 (18) LDPFQEVVLESSSVDELR PA
3
1259-1274 (16) LSEISGIPLDDIEFAK PA
3
1277-1297 (21) GTFPCDISVLDIHQDLDWNPK PA
3
1298-1318 (21) VSTLNVWPLYICDDGAVIFYR PA
3
1321-1332 (12) TEELMELTDEQR PA
3
1362-1370 (9) IYLDGAPNK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center