Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96KK3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-15 (8) GTHYENLR PA
0
18-27 (10) VVLPTPLGGR PA
0
28-44 (17) STETFVSEFPGPDTGIR PA
0
79-89 (11) LQAAASEEQAR PA
0
91-100 (10) LCDDYDEAAR PA
0
107-119 (13) HPGFFLSLLHFYR PA
0
120-153 (34) TGHLHVLDELCVFAFGQEADYWGLGENALAACCR PA
0
161-189 (29) LTQPHAWDEDSDTPSSVDPCPDEISDVQR PA
0
206-220 (15) LWLTMENPGYSLPSK PA
0
221-248 (28) LFSCVSISVVLASIAAMCIHSLPEYQAR PA
0
249-261 (13) EAAAAVAAVAAGR PA
0
275-290 (16) LEYFCIAWFSFEVSSR PA
0
291-298 (8) LLLAPSTR PA
0
299-332 (34) NFFCHPLNLIDIVSVLPFYLTLLAGVALGDQGGK PA
0
375-399 (25) EVGILLLYLAVGVSVFSGVAYTAEK PA
0
400-435 (36) EEDVGFNTIPACWWWGTVSMTTVGYGDVVPVTVAGK PA
0
436-459 (24) LAASGCILGGILVVALPITIIFNK PA
0
476-501 (26) NSNHQEFEDLLSSIDGVSEASLETSR PA
0
502-526 (25) ETSQEGQSADLESQAPSEPPHPQMY PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center