Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96LM9-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-35 (32) WQIFVLWVFWVLILWLMTPYLDLTPESAPQEK PA
0
37-53 (17) MYLVPQHCDCPWFSSGK PA
0
54-81 (28) CGCPSETLNCSSCHHTADEWNWLDACSR PA
0
92-113 (22) ESMTSDTVLWWLGMNSGSELGK PA
0
125-163 (39) LSVSHFDFYCGTCVLLGRPQIPQGSSLGNDIDQYPVVFR PA
1
164-179 (16) NASDQGSWMQLEMLLR PA
1
181-194 (14) LSDLVWTSDALSDK PA
1
195-202 (8) ILEDGLVP PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center