Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96LR5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-24 (17) VDDSPSTSGGSSDGDQR PA
0
25-33 (9) ESVQQEPER PA
0
63-80 (18) ELAEITLDPPPNCSAGPK PA
1
81-88 (8) GDNIYEWR PA
4
89-120 (32) STILGPPGSVYEGGVFFLDITFSPDYPFKPPK PA
0
127-144 (18) IYHCNINSQGVICLDILK PA
4
145-155 (11) DNWSPALTISK PA
4
156-185 (30) VLLSICSLLTDCNPADPLVGSIATQYMTNR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center