Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96P63-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MDSLVTANTK PA
1
11-21 (11) FCFDLFQEIGK PA
1
27-43 (17) NIFFSPLSLSAALGMVR PA
1
48-69 (22) SDSAHQIDEVLHFNEFSQNESK PA
1
82-92 (11) VLADSSLEGQK PA
0
94-122 (29) TTEPLDQQAGSLNNESGLVSCYFGQLLSK PA
0
128-137 (10) TDYTLSIANR PA
1
138-169 (32) LYGEQEFPICQEYLDGVIQFYHTTIESVDFQK PA
1
176-189 (14) QEINFWVECQSQGK PA
1
197-214 (18) DAINAETVLVLVNAVYFK PA
1
217-239 (23) WETYFDHENTVDAPFCLNANENK PA
1
252-259 (8) IGFIEEVK PA
1
272-283 (12) LSMFVLLPSHSK PA
1
301-321 (21) MVAWSSSENMSEESVVLSFPR PA
1
322-347 (26) FTLEDSYDLNSILQDMGITDIFDETR PA
1
348-363 (16) ADLTGISPSPNLYLSK PA
1
368-390 (23) TFVEVDENGTQAAAATGAVVSER PA
1
394-409 (16) SWVEFNANHPFLFFIR PA
1
413-421 (9) TQTILFYGR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center