Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PB1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MAALAYNLGK PA
0
12-20 (9) EINHYFSVR PA
0
24-41 (18) VLALVAVLLLAACHLASR PA
0
45-57 (13) GNDSCEYLLSSGR PA
0
63-73 (11) VWQPHSCMMHK PA
0
87-95 (9) HIAFIGDSR PA
0
98-105 (8) QLFYSFVK PA
0
118-126 (9) HENIPFEDK PA
0
132-145 (14) VDFLWHPEVNGSMK PA
0
150-172 (23) VWTEDSIAKPHVIVAGAATWSIK PA
0
173-185 (13) IHNGSSEALSQYK PA
0
186-197 (12) MNITSIAPLLEK PA
0
201-221 (21) TSDVYWVLQDPVYEDLLSENR PA
0
229-245 (17) IDAYNEAAVSILNSSTR PA
0
259-279 (21) LIAQETIMESLDGLHLPESSR PA
0
280-293 (14) ETTAMILMNVYCNK PA
0
294-314 (21) ILKPVDGSCCQPRPPVTLIQK PA
0
315-335 (21) LAACFFTLSIIGYLIFYIIHR PA
0
341-353 (13) NKPCTDLESGEEK PA
0
355-373 (19) NIINTPVSSLEILLQSFCK PA
0
374-386 (13) LGLIMAYFYMCDR PA
0
396-421 (26) FYTHSSFFIPIIYILVLGVFYNENTK PA
0
436-461 (26) GWMQLVILIYHISGASTFLPVYMHIR PA
0
462-482 (21) VLVAAYLFQTGYGHFSYFWIK PA
0
497-541 (45) LNFLVVVLCIVMDRPYQFYYFVPLVTVWFMVIYVTLALWPQIIQK PA
0
543-556 (14) ANGNCFWHFGLLLK PA
0
557-576 (20) LGFLLLFICFLAYSQGAFEK PA
0
577-585 (9) IFSLWPLSK PA
0
591-599 (9) GNVYEWWFR PA
0
605-622 (18) YVVFHGMLFAFIYLALQK PA
0
631-638 (8) GEPLFSNK PA
0
639-662 (24) ISNFLLFISVVSFLTYSIWASSCK PA
0
665-686 (22) AECNELHPSVSVVQILAFILIR PA
0
694-705 (12) SVYSSFFAWFGK PA
0
706-724 (19) ISLELFICQYHIWLAADTR PA
0
725-766 (42) GILVLIPGNPMLNIIVSTFIFVCVAHEISQITNDLAQIIIPK PA
0
775-794 (20) LACIAAFFCGLLILSSIQDK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center