Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PM5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-15 (9) EDGASGQER PA
6
42-54 (13) LCHDNNEDHQLDR PA
5
59-67 (9) EVQCINCEK PA
5
68-95 (28) IQHAQQTCEECSTLFGEYYCDICHLFDK PA
4
99-109 (11) QYHCENCGICR PA
6
114-121 (8) EDFFHCLK PA
6
122-133 (12) CNLCLAMNLQGR PA
6
143-156 (14) QNCPICLEDIHTSR PA
6
157-170 (14) VVAHVLPCGHLLHR PA
6
171-178 (8) TCYEEMLK PA
4
183-195 (13) CPLCMHSALDMTR PA
4
199-228 (30) QLDDEVAQTPMPSEYQNMTVDILCNDCNGR PA
4
229-239 (11) STVQFHILGMK PA
4
242-254 (13) ICESYNTAQAGGR PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center