Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PM5-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-14 (8) SEAPCCDK PA
0
20-32 (13) LCHDNNEDHQLDR PA
5
37-45 (9) EVQCINCEK PA
5
46-73 (28) IQHAQQTCEECSTLFGEYYCDICHLFDK PA
4
77-87 (11) QYHCENCGICR PA
6
92-99 (8) EDFFHCLK PA
6
100-111 (12) CNLCLAMNLQGR PA
6
121-134 (14) QNCPICLEDIHTSR PA
6
135-148 (14) VVAHVLPCGHLLHR PA
6
149-156 (8) TCYEEMLK PA
4
161-173 (13) CPLCMHSALDMTR PA
4
177-206 (30) QLDDEVAQTPMPSEYQNMTVDILCNDCNGR PA
4
207-217 (11) STVQFHILGMK PA
4
220-232 (13) ICESYNTAQAGGR PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center