Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PM5-8)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-15 (9) EDGASGQER PA
6
31-55 (25) AQQTCEECSTLFGEYYCDICHLFDK PA
1
59-69 (11) QYHCENCGICR PA
6
74-81 (8) EDFFHCLK PA
6
82-93 (12) CNLCLAMNLQGR PA
6
103-116 (14) QNCPICLEDIHTSR PA
6
117-130 (14) VVAHVLPCGHLLHR PA
6
134-146 (13) CPLCMHSALDMTR PA
4
150-179 (30) QLDDEVAQTPMPSEYQNMTVDILCNDCNGR PA
4
180-190 (11) STVQFHILGMK PA
4
193-205 (13) ICESYNTAQAGGR PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center