Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PQ6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MAALSPTFATSTQDSTCLQDSEFPVSSK PA
1
29-69 (41) DHSCPQNLDLFVCSGLEPHTPSVGSQESVTFQDVAVDFTEK PA
1
70-79 (10) EWPLLDSSQR PA
1
84-116 (33) DVMLENYSNLTSLGYQVGKPSLISHLEQEEEPR PA
0
121-135 (15) GAHQGACADWETPSK PA
1
138-148 (11) WSLLMEDIFGK PA
3
149-158 (10) ETPSGVTMER PA
3
165-187 (23) STEYAHLFEVFGMDPHLTQPMGR PA
3
205-219 (15) GRPHLTQHMSMYDGR PA
3
221-229 (9) MHECHQCQK PA
3
230-239 (10) AFTTSASLTR PA
3
243-257 (15) IHTGEKPYECSDCGK PA
24
258-266 (9) AFNDPSALR PA
3
275-288 (14) EKPFDCSQCGNAFR PA
3
299-307 (9) VHTGERPYK PA
31
318-325 (8) SCHLIAHK PA
3
327-341 (15) THTGERPYECHDCGK PA
3
342-350 (9) AFQHPSHLK PA
3
355-369 (15) NHTGEKPYACTQCGK PA
3
398-405 (8) SFGDLVSR PA
3
435-453 (19) THMNSHTGEKPYGCDLCGK PA
3
454-465 (12) AFSASSNLTAHR PA
3
474-481 (8) YECAACGK PA
3
482-489 (8) VFGDYLSR PA
3
492-499 (8) HMSVHLVK PA
3
523-537 (15) SHTGEKPYECDHCGK PA
5
538-549 (12) AFSIGSNLNVHR PA
3
551-565 (15) IHTGEKPYECLVCGK PA
3
566-574 (9) AFSDHSSLR PA
3
585-592 (8) LFVSSVWK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center