Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PQ6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MAALSPTFATSTQDSTCLQDSEFPVSSK PA
1
29-69 (41) DHSCPQNLDLFVCSGLEPHTPSVGSQESVTFQDVAVDFTEK PA
1
70-79 (10) EWPLLDSSQR PA
1
84-103 (20) DVMLENYSNLTSLDWETPSK PA
0
106-116 (11) WSLLMEDIFGK PA
3
117-126 (10) ETPSGVTMER PA
3
133-155 (23) STEYAHLFEVFGMDPHLTQPMGR PA
3
173-187 (15) GRPHLTQHMSMYDGR PA
3
189-197 (9) MHECHQCQK PA
3
198-207 (10) AFTTSASLTR PA
3
211-225 (15) IHTGEKPYECSDCGK PA
24
226-234 (9) AFNDPSALR PA
3
243-256 (14) EKPFDCSQCGNAFR PA
3
267-275 (9) VHTGERPYK PA
31
286-293 (8) SCHLIAHK PA
3
295-309 (15) THTGERPYECHDCGK PA
3
310-318 (9) AFQHPSHLK PA
3
323-337 (15) NHTGEKPYACTQCGK PA
3
366-373 (8) SFGDLVSR PA
3
403-421 (19) THMNSHTGEKPYGCDLCGK PA
3
422-433 (12) AFSASSNLTAHR PA
3
442-449 (8) YECAACGK PA
3
450-457 (8) VFGDYLSR PA
3
460-467 (8) HMSVHLVK PA
3
491-505 (15) SHTGEKPYECDHCGK PA
5
506-517 (12) AFSIGSNLNVHR PA
3
519-533 (15) IHTGEKPYECLVCGK PA
3
534-542 (9) AFSDHSSLR PA
3
553-560 (8) LFVSSVWK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center