Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PQ6-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-31 (31) MLENYSNLTSLGYQVGKPSLISHLEQEEEPR PA
0
36-50 (15) GAHQGACADWETPSK PA
1
53-63 (11) WSLLMEDIFGK PA
3
64-73 (10) ETPSGVTMER PA
3
80-102 (23) STEYAHLFEVFGMDPHLTQPMGR PA
3
120-134 (15) GRPHLTQHMSMYDGR PA
3
136-144 (9) MHECHQCQK PA
3
145-154 (10) AFTTSASLTR PA
3
158-172 (15) IHTGEKPYECSDCGK PA
24
173-181 (9) AFNDPSALR PA
3
190-203 (14) EKPFDCSQCGNAFR PA
3
214-222 (9) VHTGERPYK PA
31
233-240 (8) SCHLIAHK PA
3
242-256 (15) THTGERPYECHDCGK PA
3
257-265 (9) AFQHPSHLK PA
3
270-284 (15) NHTGEKPYACTQCGK PA
3
313-320 (8) SFGDLVSR PA
3
350-368 (19) THMNSHTGEKPYGCDLCGK PA
3
369-380 (12) AFSASSNLTAHR PA
3
389-396 (8) YECAACGK PA
3
397-404 (8) VFGDYLSR PA
3
407-414 (8) HMSVHLVK PA
3
438-452 (15) SHTGEKPYECDHCGK PA
5
453-464 (12) AFSIGSNLNVHR PA
3
466-480 (15) IHTGEKPYECLVCGK PA
3
481-489 (9) AFSDHSSLR PA
3
500-507 (8) LFVSSVWK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center