Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PS1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MAGYQLWSPWTPLDESFQWLR PA
0
22-30 (9) HTTPTPSSK PA
0
35-71 (37) ASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPK PA
0
72-80 (9) LPCHTSELR PA
0
96-105 (10) LSGVDSVFGR PA
0
106-113 (8) VITAQPPK PA
0
133-141 (9) EHQWPIGLK PA
0
142-153 (12) EPQIQMTVTMCK PA
0
158-167 (10) SILLLYATYK PA
0
169-177 (9) CTFALQHSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center