Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PS6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-27 (24) HSWIHLYVMASAMSSSPIFFFFQR PA
0
28-35 (8) WSLTLSLR PA
0
36-65 (30) LECSSAIIKPTAASNSCVQVNLPPSMCDYR PA
0
66-74 (9) HEPLCLAFL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center