Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PU5-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MATGLGEPVYGLSEDEGESR PA
3
26-34 (9) VVSGIDLAK PA
5
36-46 (11) DIFGASDPYVK PA
5
47-56 (10) LSLYVADENR PA
5
57-64 (8) ELALVQTK PA
5
74-81 (8) WNEEFYFR PA
5
89-98 (10) LLFEVFDENR PA
6
102-129 (28) DDFLGQVDVPLSHLPTEDPTMERPYTFK PA
5
156-167 (12) NGGQDEENSDQR PA
7
168-202 (35) DDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEK PA
7
209-217 (9) TYYVNHNNR PA
7
218-238 (21) TTQWHRPSLMDVSSESDNNIR PA
7
239-247 (9) QINQEAAHR PA
7
254-301 (48) HISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGSR PA
7
302-313 (12) TSPQELSEELSR PA
7
315-332 (18) LQITPDSNGEQFSSLIQR PA
7
340-358 (19) SCSVTDAVAEQGHLPPGAK PA
0
368-389 (22) DTLSNPQSPQPSPYNSPKPQHK PA
7
390-402 (13) VTQSFLPPGWEMR PA
7
403-417 (15) IAPNGRPFFIDHNTK PA
7
418-425 (8) TTTWEDPR PA
11
436-453 (18) TSLNPNDLGPLPPGWEER PA
7
460-468 (9) TFYIDHNSK PA
7
469-476 (8) ITQWEDPR PA
10
477-491 (15) LQNPAITGPAVPYSR PA
7
506-513 (8) KPADIPNR PA
7
521-529 (9) NNIFEESYR PA
7
544-552 (9) LWIEFESEK PA
7
553-561 (9) GLDYGGVAR PA
11
562-569 (8) EWFFLLSK PA
7
570-611 (42) EMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGR PA
7
612-621 (10) VAGLAVFHGK PA
7
622-633 (12) LLDGFFIRPFYK PA
11
639-657 (19) QITLNDMESVDSEYYNSLK PA
7
658-700 (43) WILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENK PA
7
702-711 (10) EYIDLVIQWR PA
7
719-737 (19) QMNAFLEGFTELLPIDLIK PA
7
738-760 (23) IFDENELELLMCGLGDVDVNDWR PA
11
767-781 (15) NGYCPNHPVIQWFWK PA
7
782-790 (9) AVLLMDAEK PA
7
794-803 (10) LLQFVTGTSR PA
11
804-831 (28) VPMNGFAELYGSNGPQLFTIEQWGSPEK PA
7
842-854 (13) LDLPPYETFEDLR PA
7
857-871 (15) LLMAVENAQGFEGVD PA
7
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center