Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PU5-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-12 (9) LAFEQGESR PA
1
18-26 (9) VVSGIDLAK PA
5
28-38 (11) DIFGASDPYVK PA
5
39-48 (10) LSLYVADENR PA
5
49-56 (8) ELALVQTK PA
5
66-73 (8) WNEEFYFR PA
5
81-90 (10) LLFEVFDENR PA
6
94-121 (28) DDFLGQVDVPLSHLPTEDPTMERPYTFK PA
5
148-159 (12) NGGQDEENSDQR PA
7
160-194 (35) DDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEK PA
7
201-209 (9) TYYVNHNNR PA
7
210-230 (21) TTQWHRPSLMDVSSESDNNIR PA
7
231-239 (9) QINQEAAHR PA
7
246-293 (48) HISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGSR PA
7
294-305 (12) TSPQELSEELSR PA
7
307-324 (18) LQITPDSNGEQFSSLIQR PA
7
332-366 (35) SCSVTDAVAEQGHLPPPSVAYVHTTPGLPSGWEER PA
2
373-381 (9) TYYVNHNNR PA
7
382-414 (33) TTTWTRPIMQLAEDGASGSATNSNNHLIEPQIR PA
5
418-434 (17) SLSSPTVTLSAPLEGAK PA
6
444-465 (22) DTLSNPQSPQPSPYNSPKPQHK PA
7
466-478 (13) VTQSFLPPGWEMR PA
7
479-493 (15) IAPNGRPFFIDHNTK PA
7
494-501 (8) TTTWEDPR PA
11
512-529 (18) TSLNPNDLGPLPPGWEER PA
7
536-544 (9) TFYIDHNSK PA
7
545-552 (8) ITQWEDPR PA
10
553-567 (15) LQNPAITGPAVPYSR PA
7
582-589 (8) KPADIPNR PA
7
597-605 (9) NNIFEESYR PA
7
620-628 (9) LWIEFESEK PA
7
629-637 (9) GLDYGGVAR PA
11
638-645 (8) EWFFLLSK PA
7
646-687 (42) EMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGR PA
7
688-697 (10) VAGLAVFHGK PA
7
698-709 (12) LLDGFFIRPFYK PA
11
715-733 (19) QITLNDMESVDSEYYNSLK PA
7
734-776 (43) WILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENK PA
7
778-787 (10) EYIDLVIQWR PA
7
795-813 (19) QMNAFLEGFTELLPIDLIK PA
7
814-836 (23) IFDENELELLMCGLGDVDVNDWR PA
11
843-857 (15) NGYCPNHPVIQWFWK PA
7
858-866 (9) AVLLMDAEK PA
7
870-879 (10) LLQFVTGTSR PA
11
880-907 (28) VPMNGFAELYGSNGPQLFTIEQWGSPEK PA
7
918-930 (13) LDLPPYETFEDLR PA
7
933-947 (15) LLMAVENAQGFEGVD PA
7
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center