Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PU5-7)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-12 (9) LAFEQGESR PA
1
18-26 (9) VVSGIDLAK PA
5
28-38 (11) DIFGASDPYVK PA
5
39-48 (10) LSLYVADENR PA
5
49-56 (8) ELALVQTK PA
5
66-73 (8) WNEEFYFR PA
5
81-90 (10) LLFEVFDENR PA
6
94-121 (28) DDFLGQVDVPLSHLPTEDPTMERPYTFK PA
5
148-159 (12) NGGQDEENSDQR PA
7
160-194 (35) DDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEK PA
7
201-209 (9) TYYVNHNNR PA
7
210-230 (21) TTQWHRPSLMDVSSESDNNIR PA
7
231-239 (9) QINQEAAHR PA
7
246-293 (48) HISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGSR PA
7
294-305 (12) TSPQELSEELSR PA
7
307-324 (18) LQITPDSNGEQFSSLIQR PA
7
332-354 (23) SCSVTDAVAEQGHLPPPSAPAGR PA
2
357-386 (30) SSTVTGGEEPTPSVAYVHTTPGLPSGWEER PA
2
393-401 (9) TYYVNHNNR PA
7
402-434 (33) TTTWTRPIMQLAEDGASGSATNSNNHLIEPQIR PA
5
438-454 (17) SLSSPTVTLSAPLEGAK PA
6
464-485 (22) DTLSNPQSPQPSPYNSPKPQHK PA
7
486-498 (13) VTQSFLPPGWEMR PA
7
499-513 (15) IAPNGRPFFIDHNTK PA
7
514-521 (8) TTTWEDPR PA
11
532-549 (18) TSLNPNDLGPLPPGWEER PA
7
556-564 (9) TFYIDHNSK PA
7
565-572 (8) ITQWEDPR PA
10
573-587 (15) LQNPAITGPAVPYSR PA
7
602-609 (8) KPADIPNR PA
7
617-625 (9) NNIFEESYR PA
7
640-648 (9) LWIEFESEK PA
7
649-657 (9) GLDYGGVAR PA
11
658-665 (8) EWFFLLSK PA
7
666-707 (42) EMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGR PA
7
708-717 (10) VAGLAVFHGK PA
7
718-729 (12) LLDGFFIRPFYK PA
11
735-753 (19) QITLNDMESVDSEYYNSLK PA
7
754-796 (43) WILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENK PA
7
798-807 (10) EYIDLVIQWR PA
7
815-833 (19) QMNAFLEGFTELLPIDLIK PA
7
834-856 (23) IFDENELELLMCGLGDVDVNDWR PA
11
863-877 (15) NGYCPNHPVIQWFWK PA
7
878-886 (9) AVLLMDAEK PA
7
890-899 (10) LLQFVTGTSR PA
11
900-927 (28) VPMNGFAELYGSNGPQLFTIEQWGSPEK PA
7
938-950 (13) LDLPPYETFEDLR PA
7
953-967 (15) LLMAVENAQGFEGVD PA
7
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center