Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96PV4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MALTLLEDWCK PA
0
20-40 (21) ALLIVGIPMECSEVEIQDTVK PA
0
41-50 (10) AGLQPLCAYR PA
0
64-85 (22) AVFIELADTVNYTTLPSHIPGK PA
0
86-96 (11) GGSWEVVVKPR PA
0
97-105 (9) NPDDEFLSR PA
0
123-143 (21) ALGCCSLPAESLDAEVMPQVR PA
0
144-151 (8) SPPLEPPK PA
0
161-196 (36) VFSGTASPSPGEETFEDWLEQVTEIMPIWQVSEVEK PA
0
206-213 (8) GPALSIMR PA
0
214-232 (19) VLQANNDSITVEQCLDALK PA
0
296-303 (8) VAMTPALR PA
0
313-323 (11) GCPPNFLELMK PA
0
327-339 (13) DEEEWENTEAVMK PA
0
358-372 (15) AEASVSAPQATVQAR PA
0
373-391 (19) SFSDSSPQTIQGGLPPLVK PA
0
395-402 (8) LLGSESTR PA
0
403-413 (11) GEDHGQATYPK PA
0
414-421 (8) AENQTPGR PA
0
422-448 (27) EGPQAAGEELGNEAGAGAMSHPKPWET PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center