Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96RI9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MVNNFSQAEAVELCYK PA
0
17-24 (8) NVNESCIK PA
0
25-32 (8) TPYSPGPR PA
0
33-61 (29) SILYAVLGFGAVLAAFGNLLVMIAILHFK PA
0
62-92 (31) QLHTPTNFLIASLACADFLVGVTVMPFSTVR PA
0
93-106 (14) SVESCWYFGDSYCK PA
0
107-130 (24) FHTCFDTSFCFASLFHLCCISVDR PA
0
131-143 (13) YIAVTDPLTYPTK PA
0
144-219 (76) FTVSVSGICIVLSWFFSVTYSFSIFYTGANEEGIEELVVALTCVGGCQAPLNQNWVLLCFLLFFIPNVAMVFIYSK PA
0
231-246 (16) IESTASQAQSSSESYK PA
0
259-320 (62) TLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILVWCVYYNSAMNPLIYAFFYQWFGK PA
0
333-348 (16) TDSSTTNLFSEEVETD PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center