Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96RY7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-63 (63) MALYYDHQIEAPDAAGSPSFISWHPVHPFLAVAYISTTSTGSVDIYLEQGECVPDTHVERPFR PA
0
64-73 (10) VASLCWHPTR PA
0
74-90 (17) LVLAVGWETGEVTVFNK PA
0
94-110 (17) EQHTMPLTHTADITVLR PA
0
111-123 (13) WSPSGNCLLSGDR PA
0
124-131 (8) LGVLLLWR PA
0
138-145 (8) VQGTPLLK PA
0
151-158 (8) HLTHCIFR PA
0
159-171 (13) LPPPGEDLVQLAK PA
0
172-179 (8) AAVSGDEK PA
0
180-187 (8) ALDMFNWK PA
0
189-196 (8) SSSGSLLK PA
0
197-220 (24) MGSHEGLLFFVSLMDGTVHYVDEK PA
0
223-241 (19) TTQVVSADSTIQMLFYMEK PA
0
243-253 (11) EALVVVTENLR PA
0
254-264 (11) LSLYTVPPEGK PA
0
281-301 (21) ADIALIEGSLLVMAVGEAALR PA
0
308-318 (11) GENYILSPDEK PA
0
324-334 (11) GENMNCVCYCK PA
0
337-345 (9) GLLAAGTDR PA
0
354-366 (13) VPDFLGSPGAEGK PA
0
369-389 (21) WALQTPTELQGNITQIQWGSR PA
0
391-407 (17) NLLAVNSVISVAILSER PA
0
408-441 (34) AMSSHFHQQVAAMQVSPSLLNVCFLSTGVAHSLR PA
0
442-453 (12) TDMHISGVFATK PA
0
454-462 (9) DAVAVWNGR PA
0
463-475 (13) QVAIFELSGAAIR PA
0
476-501 (26) SAGTFLCETPVLAMHEENVYTVESNR PA
0
513-544 (32) QLLLFSETEGNPCFLDICGNFLVVGTDLAHFK PA
0
561-576 (16) SLAELVPGVGGIASLR PA
0
577-590 (14) CSSSGSTISILPSK PA
0
591-598 (8) ADNSPDSK PA
0
599-615 (17) ICFYDVEMDTVTVFDFK PA
0
623-634 (12) ETLSFNEQETNK PA
0
635-644 (10) SHLFVDEGLK PA
0
645-659 (15) NYVPVNHFWDQSEPR PA
0
660-671 (12) LFVCEAVQETPR PA
0
672-685 (14) SQPQSANGQPQDGR PA
0
686-732 (47) AGPAADVLILSFFISEEHGFLLHESFPRPATSHSLLGMEVPYYYFTR PA
0
740-756 (17) EDEVEPGCHHIPQMVSR PA
0
761-770 (10) DFVGLEDCDK PA
0
774-793 (20) DAMLHFSFFVTIGDMDEAFK PA
0
800-809 (10) SEAVWENMAR PA
0
822-831 (10) VCLGNMGHAR PA
1
838-848 (11) EAEQEPELEAR PA
1
849-867 (19) VAVLATQLGMLEDAEQLYR PA
1
885-897 (13) WQEALQVAEHHDR PA
1
907-919 (13) YAGHLEASADCSR PA
1
937-951 (15) MLSEDLPSLELYVNK PA
1
960-982 (23) WWAQYLESQGEMDAALHYYELAR PA
1
990-999 (10) IHCFQGNVQK PA
1
1000-1018 (19) AAQIANETGNLAASYHLAR PA
1
1019-1035 (17) QYESQEEVGQAVHFYTR PA
1
1048-1072 (25) ENGLDDQLMNLALLSSPEDMIEAAR PA
1
1097-1128 (32) ALELAFATQQFVALQLIAEDLDETSDPALLAR PA
1
1129-1141 (13) CSDFFIEHSQYER PA
1
1142-1150 (9) AVELLLAAR PA
1
1152-1173 (22) YQEALQLCLGQNMSITEEMAEK PA
1
1179-1188 (10) DSSDLPEESR PA
1
1190-1201 (12) ELLEQIADCCMR PA
1
1202-1210 (9) QGSYHLATK PA
1
1234-1242 (9) ITFFASVSR PA
1
1245-1260 (16) EIYIMAANYLQSLDWR PA
1
1268-1275 (8) NIIGFYTK PA
1
1278-1302 (25) ALDLLAGFYDACAQVEIDEYQNYDK PA
1
1303-1312 (10) AHGALTEAYK PA
1
1321-1328 (8) SPLDQETR PA
1
1359-1374 (16) QCELLLEEPDLDSTIR PA
1
1375-1388 (14) IGDVYGFLVEHYVR PA
1
1390-1397 (8) EEYQTAYR PA
1
1406-1425 (20) LPLANMSYYVSPQAVDAVHR PA
1
1426-1433 (8) GLGLPLPR PA
1
1441-1448 (8) HNSMEDAR PA
1
1449-1462 (14) ELDEEVVEEADDDP PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center