Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96S82-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MSLSDWHLAVK PA
0
12-20 (9) LADQPLTPK PA
0
25-44 (20) LPETELGEYSLGGYSISFLK PA
0
51-68 (18) LQESVPDPELIDLIYCGR PA
0
72-91 (20) DDQTLDFYGIQPGSTVHVLR PA
0
93-106 (14) SWPEPDQKPEPVDK PA
0
115-127 (13) VLHTALHSSSSYR PA
0
138-163 (26) ESLDQIIVATPGLSSDPIALGVLQDK PA
0
164-210 (47) DLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSR PA
0
211-218 (8) SMPSSSYR PA
0
219-241 (23) DMPGGFLFEGLSDDEDDFHPNTR PA
0
242-346 (105) STPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLR PA
0
347-358 (12) DMGIQDDELSLR PA
0
359-380 (22) ALQATGGDIQAALELIFAGGAP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center