Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q96T54-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
16-46 (31) GCAVPSTVLLLLAYLAYLALGTGVFWTLEGR PA
1
60-79 (20) WELLQNFTCLDRPALDSLIR PA
1
87-100 (14) NGASLLSNTTSMGR PA
1
101-130 (30) WELVGSFFFSVSTITTIGYGNLSPNTMAAR PA
1
131-150 (20) LFCIFFALVGIPLNLVVLNR PA
1
151-165 (15) LGHLMQQGVNHWASR PA
1
166-175 (10) LGGTWQDPDK PA
1
178-236 (59) WLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQR PA
0
243-261 (19) NMVSLWILFGMAWLALIIK PA
0
262-272 (11) LILSQLETPGR PA
0
273-282 (10) VCSCCHHSSK PA
0
297-330 (34) EPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center