Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q99680-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MCFSPILEINMQSESNITVR PA
0
21-69 (49) DDIDDINTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNLTVLVLYCMK PA
0
70-140 (71) SNLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESNTALICCFHEACVSFASVSTAINVFAITLDR PA
0
141-150 (10) YDISVKPANR PA
0
157-193 (37) AVMLMISIWIFSFFSFLIPFIEVNFFSLQSGNTWENK PA
0
194-233 (40) TLLCVSTNEYYTELGMYYHLLVQIPIFFFTVVVMLITYTK PA
0
234-241 (8) ILQALNIR PA
0
259-278 (20) TISLTTQHEATDMSQSSGGR PA
0
286-295 (10) TSVSVIIALR PA
0
314-347 (34) MSLLIISTFLLCWTPISVLNTTILCLGPSDLLVK PA
0
350-371 (22) LCFLVMAYGTTIFHPLLYAFTR PA
0
386-409 (24) VVSIVEADPLPNNAVIHNSWIDPK PA
0
414-422 (9) ITFEDSEIR PA
0
425-433 (9) CLVPQVVTD PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center