Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q99708-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MNISGSSCGSPNSADTSSDFK PA
2
34-41 (8) EVQGLQVK PA
2
92-100 (9) CAVTEEHMR PA
2
103-110 (8) QQEFENIR PA
2
116-124 (9) LITELMNER PA
2
125-132 (8) NTLQEENK PA
2
134-141 (8) LSEQLQQK PA
2
142-175 (34) IENDQQHQAAELECEEDVIPDSPITAFSFSGVNR PA
2
186-193 (8) YIEQTHTK PA
2
194-204 (11) LEHSVCANEMR PA
2
209-237 (29) SSTHPQHNPNENEILVADTYDQSQSPMAK PA
2
238-248 (11) AHGTSSYTPDK PA
2
249-291 (43) SSFNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHK PA
2
293-300 (8) QPFEESTR PA
2
315-324 (10) TPPQEELPTR PA
2
325-337 (13) VSSPVFGATSSIK PA
2
338-355 (18) SGLDLNTSLSPSLLQPGK PA
2
361-371 (11) TLPFSNTCISR PA
2
379-396 (18) SEDSALFTHHSLGSEVNK PA
2
397-404 (8) IIIQSSNK PA
2
411-421 (11) NISESLGEQNR PA
2
450-467 (18) TEEESEHEVSCPQASFDK PA
2
468-496 (29) ENAFPFPMDNQFSMNGDCVMDKPLDLSDR PA
2
506-513 (8) SQGSETSK PA
2
518-526 (9) QVTLYEALK PA
2
538-547 (10) ASDGNCTLPK PA
2
548-566 (19) DSPGEPCSQECIILQPLNK PA
2
567-578 (12) CSPDNKPSLQIK PA
2
592-604 (13) ESLETENVLDDIK PA
2
605-613 (9) SAGSHEPIK PA
2
618-635 (18) SDHGGCELASVLQLNPCR PA
2
641-667 (27) SLQNNQDVSFENIQWSIDPGADLSQYK PA
2
668-676 (9) MDVTVIDTK PA
2
683-702 (20) LGGETVDMDCTLVSETVLLK PA
2
720-730 (11) MNDSLEDMFDR PA
2
731-759 (29) TTHEEYESCLADSFSQAADEEEELSTATK PA
2
775-782 (8) AFVEPYFK PA
2
783-794 (12) GDESIMQICQQK PA
0
799-817 (19) NWLPAQDTDSATFHPTHQR PA
0
839-847 (9) ILILVLVQK PA
0
848-859 (12) DVSLTTQYFLQK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center