Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q99942-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MAAAEEEDGGPEGPNR PA
0
19-35 (17) GGAGATFECNICLETAR PA
0
36-61 (26) EAVVSVCGHLYCWPCLHQWLETRPER PA
0
83-91 (9) GSQKPQDPR PA
0
94-108 (15) TPPRPQGQRPAPESR PA
0
109-145 (37) GGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFR PA
0
147-180 (34) GTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center