Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q99966-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MPTTSRPALDVK PA
0
20-37 (18) EDANQEMSSVAYSNLAVK PA
1
41-56 (16) AVAILHYPGVASNGTK PA
1
57-99 (43) ASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMHLQK PA
1
100-169 (70) LNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDR PA
1
170-193 (24) ANELPELWLGQNEFDFTADFPSSC PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center