Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q99986-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
18-34 (17) HLAEQFAVGEIITDMAK PA
0
39-71 (33) VGLPIGQGGFGCIYLADMNSSESVGSDAPCVVK PA
0
72-85 (14) VEPSDNGPLFTELK PA
0
90-98 (9) AAKPEQIQK PA
0
113-121 (9) YWGSGLHDK PA
0
153-160 (8) TVLQLSLR PA
0
161-179 (19) ILDILEYIHEHEYVHGDIK PA
0
180-188 (9) ASNLLLNYK PA
0
189-203 (15) NPDQVYLVDYGLAYR PA
0
204-211 (8) YCPEGVHK PA
0
220-240 (21) CHDGTIEFTSIDAHNGVAPSR PA
0
242-266 (25) GDLEILGYCMIQWLTGHLPWEDNLK PA
0
280-288 (9) ENIASLMDK PA
0
294-301 (8) NKPGEIAK PA
0
308-321 (14) LLDYTEKPLYENLR PA
0
322-329 (8) DILLQGLK PA
0
339-350 (12) LDLSVVENGGLK PA
0
367-387 (21) EPGVEDTEWSNTQTEEAIQTR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center