Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BQ04-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-11 (8) LFIGNLPR PA
4
12-19 (8) EATEQEIR PA
4
20-27 (8) SLFEQYGK PA
4
28-35 (8) VLECDIIK PA
4
36-45 (10) NYGFVHIEDK PA
4
46-53 (8) TAAEDAIR PA
4
60-71 (12) LHGVNINVEASK PA
4
80-95 (16) LHVGNISPTCTNQELR PA
0
98-111 (14) FEEYGPVIECDIVK PA
4
112-120 (9) DYAFVHMER PA
4
121-129 (9) AEDAVEAIR PA
4
130-139 (10) GLDNTEFQGK PA
2
141-149 (9) MHVQLSTSR PA
2
152-164 (13) TAPGMGDQSGCYR PA
2
183-198 (16) VADFTEQYNEQYGAVR PA
0
199-222 (24) TPYTMGYGESMYYNDAYGALDYYK PA
0
228-273 (46) SYEAVAAAAAASAYNYAEQTMSHLPQVQSTTVTSHLNSTSVDPYDR PA
0
274-301 (28) HLLPNSGAAATSAAMAAAAATTSSYYGR PA
0
309-336 (28) AAAMLPTVGEGYGYGPESELSQASAATR PA
0
337-344 (8) NSLYDMAR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center