Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BQ70-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
15-29 (15) GQEPLGPGALHFDLR PA
0
30-40 (11) DDDDAEEEGPK PA
0
62-80 (19) FELINIDDLEDDPVVNGER PA
0
81-94 (14) SGCALTDAVAPGNK PA
0
106-124 (19) TDGDDTETVPSEQSHASGK PA
0
137-152 (16) SSTGEASENGLEDIDR PA
0
157-174 (18) IEDSTGLNRPGPAPLSSR PA
0
176-183 (8) HVLYVEHR PA
0
184-192 (9) HLNPDTELK PA
0
199-207 (9) AILGEQRPR PA
0
216-223 (8) CTWLTTPK PA
0
229-237 (9) YSKPGLSMR PA
0
244-262 (19) GLSFFAFEHSEEYQQAQHK PA
0
263-297 (35) FLVAVESMEPNNIVVLLQTSPYHVDSLLQLSDACR PA
0
298-306 (9) FQEDQEMAR PA
0
312-332 (21) ALYSMECAFHPLFSLTSGACR PA
0
342-349 (8) SFYLALYK PA
0
369-392 (24) LILSLEPDEDPLCMLLLIDHLALR PA
0
402-410 (9) LFQEWEAHR PA
0
411-444 (34) NLSQLPNFAFSVPLAYFLLSQQTDLPECEQSSAR PA
0
447-481 (35) ASLLIQQALTMFPGVLLPLLESCSVRPDASVSSHR PA
0
482-505 (24) FFGPNAEISQPPALSQLVNLYLGR PA
0
512-543 (32) EPATMSWLEENVHEVLQAVDAGDPAVEACENR PA
0
558-565 (8) HVILSEIK PA
0
566-600 (35) EAVAALPPDVTTQSVMGFDPLPPSDTIYSYVRPER PA
0
601-615 (15) LSPISHGNTIALFFR PA
0
616-638 (23) SLLPNYTMEGERPEEGVAGGLNR PA
0
651-676 (26) DMMANFHLNDLEAPHEDDAEGEGEWD PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center