Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BR11-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-15 (9) APWSAALQR PA
0
17-41 (25) YFDLGIWTAPISPMALTMLNGLLIK PA
0
42-54 (13) DSSPPMLLHQVNK PA
0
55-83 (29) TAQLDTFNYQSCFMQSVFDHFPEILFIHR PA
0
91-101 (11) VLYTFLVDGPR PA
0
102-110 (9) VQLEGHLAR PA
0
111-119 (9) AVYFAIPAK PA
0
120-133 (14) EDTEGLAQMFQVFK PA
0
142-175 (34) VCTILVDPHFLPLPILAMEFPTAEVLLSAFHICK PA
0
181-192 (12) FYQLSLERPVER PA
0
193-211 (19) LLLTSLQSTMCSATAGNLR PA
0
213-225 (13) LYTLLSNCIPPAK PA
0
226-238 (13) LPELHSHWLLNDR PA
0
249-276 (28) AESSHYFQSLEVTTHILSQFFGTTPSEK PA
0
277-284 (8) QGMASLFR PA
0
285-293 (9) YMQQNSADK PA
0
294-317 (24) ANFNQGLCAQNNHAPSDTIPESPK PA
0
318-351 (34) LEQLVESHIQHSLNAICTGPAAQLCLGELAVVQK PA
0
352-362 (11) STHLIGSGSEK PA
0
363-373 (11) MNIQILEDTHK PA
0
374-395 (22) VQPQPPASCSCYFNQAFHLPCR PA
0
396-404 (9) HILAMLSAR PA
0
406-432 (27) QVLQPDMLPAQWTAGCATSLDSILGSK PA
0
440-459 (20) HLAVTHLTEEVGQLLQHCTK PA
0
471-485 (15) ELADSWIGPYEQVQL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center