Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BRX9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MAFPEPKPRPPELPQK PA
0
20-29 (10) TLDCGQGAVR PA
0
33-47 (15) FNVDGNYCLTCGSDK PA
0
62-89 (28) TYSGHGYEVLDAAGSFDNSSLCSGGGDK PA
0
90-103 (14) AVVLWDVASGQVVR PA
0
112-134 (23) VNTVQFNEEATVILSGSIDSSIR PA
0
142-153 (12) RPEPVQTLDEAR PA
0
161-174 (14) VSDHEILAGSVDGR PA
0
182-201 (20) MGQLFSDYVGSPITCTCFSR PA
0
202-216 (15) DGQCTLVSSLDSTLR PA
0
221-230 (10) DTGELLGEYK PA
0
239-246 (8) LDCCLSER PA
0
247-258 (12) DTHVVSCSEDGK PA
0
259-304 (46) VFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWR PA
0
305-315 (11) EEAYEAEDGAG PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center