Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BSE2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MTEQETLALLEVK PA
0
21-31 (11) SSPQALVPNGR PA
0
32-48 (17) QPEGEGGAESPGAESLR PA
0
49-95 (47) VGSSAGSPTAIEGAEDGLDSTVSEAATLPWGTGPQPSAPFPDPPGWR PA
0
96-109 (14) DIEPEPPESEPLTK PA
0
110-124 (15) LEELPEDDANLLPEK PA
0
128-139 (12) AFVPIDLQCIER PA
0
140-148 (9) QPQEDLIVR PA
0
149-157 (9) CEAGEGECR PA
0
164-172 (9) VTHPDPTER PA
0
174-195 (22) WAEAVVRPPGCSCGGCGSCGDR PA
0
200-228 (29) AVASVGAALILFPCLLYGAYAFLPFDVPR PA
0
242-274 (33) CGVFATFPIVLGILVYGLSLLCFSALRPFGEPR PA
0
283-311 (29) YVAQSVQLFILYFFNLAVLSTYLPQDTLK PA
0
312-324 (13) LLPLLTGLFAVSR PA
0
325-335 (11) LIYWLTFAVGR PA
0
339-367 (29) GFGYGLTFLPLLSMLMWNLYYMFVVEPER PA
0
368-375 (8) MLTATESR PA
0
376-383 (8) LDYPDHAR PA
0
384-394 (11) SASDYRPRPWG PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center