Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BSW7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MAYIQLEPLNEGFLSR PA
0
17-24 (8) ISGLLLCR PA
0
34-65 (32) CYESSCCQSSEDEVEILGPFPAQTPPWLMASR PA
0
70-85 (16) DGDSVHTASEVPLTPR PA
0
116-135 (20) RPSSPLIDIKPIEFGVLSAK PA
0
137-145 (9) EPIQPSVLR PA
0
147-155 (9) TYNPDDYFR PA
0
157-182 (26) FEPHLYSLDSNSDDVDSLTDEEILSK PA
0
183-204 (22) YQLGMLHFSTQYDLLHNHLTVR PA
0
210-221 (12) DLPPPISHDGSR PA
0
222-232 (11) QDMAHSNPYVK PA
0
233-240 (8) ICLLPDQK PA
0
251-259 (9) TQKPVFEER PA
0
260-271 (12) YTFEIPFLEAQR PA
0
273-283 (11) TLLLTVVDFDK PA
0
293-304 (12) VSVPLCEVDLVK PA
0
311-337 (27) ALIPSSQNEVELGELLLSLNYLPSAGR PA
0
347-362 (16) QLLQTDVSQGSDPFVK PA
0
363-370 (8) IQLVHGLK PA
0
382-395 (14) GTIDPFYNESFSFK PA
0
396-416 (21) VPQEELENASLVFTVFGHNMK PA
0
417-424 (8) SSNDFIGR PA
0
425-441 (17) IVIGQYSSGPSETNHWR PA
0
449-458 (10) TAVEQWHSLR PA
0
466-474 (9) VSPASLEVT PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center