Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BT92-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MALPTLPSYWCSQQR PA
0
32-39 (8) QQWEQNSR PA
0
43-50 (8) MSDICSSK PA
0
89-100 (12) QLMQEEQDLLAR PA
0
107-114 (8) LSMNLQER PA
0
133-144 (12) LIAEQLLYEHWK PA
0
152-160 (9) EMELDLHQK PA
0
161-170 (10) HVVNSWEMQK PA
0
175-185 (11) QQEATAEQENK PA
0
215-228 (14) LQAEALLQQMEELK PA
0
276-284 (9) HQYNAQLSR PA
0
286-297 (12) TQQIQEELEADR PA
0
299-306 (8) ILQALLEK PA
0
319-329 (11) EQVMADVAWMK PA
0
330-340 (11) QAIEEQLQLER PA
0
343-351 (9) EAELQMLLR PA
0
375-383 (9) LMSEVLTGR PA
0
435-444 (10) QELEAQVAER PA
0
446-463 (18) LQAWEADQQEEEEEEEAR PA
0
465-494 (30) VEQLSDALLQQEAETMAEQGYRPKPYGHPK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center