Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BTD3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MVLPPPDR PA
0
10-37 (28) HVCLTTLVIMGSMAVMDAYLVEQNQGPR PA
0
39-57 (19) IGVCIIVLVGDVCFLLVLR PA
0
58-68 (11) YVAVWVGAEVR PA
0
73-89 (17) GYAMILWFLYIFVLEIK PA
0
90-98 (9) LYFIFQNYK PA
0
103-110 (8) GAADPVAR PA
0
112-133 (22) ALTLLLSVCVPGLFLLLVALDR PA
0
150-172 (23) LFWVALDLLDLLDMQASLWEPPR PA
0
173-213 (41) SGLPLWAEGLTFFYCYMLLLVLPCVALSEVSMQGEHIAPQK PA
0
214-233 (20) MMLYPVLSLATVNVVAVLAR PA
0
234-241 (8) AANMALFR PA
0
245-252 (8) VSAIFVGK PA
0
253-260 (8) NVVALATK PA
0
261-268 (8) ACTFLEYR PA
0
273-290 (18) DFPPPALSLELQPPPPQR PA
0
291-314 (24) NSVPPPPPPLHGPPGRPHMSSPTR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center