Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BVA0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MATPVVTK PA
0
13-30 (18) LQEIVAHASNVSSLVLGK PA
0
35-44 (10) LLATGGDDCR PA
0
45-70 (26) VNLWSINKPNCIMSLTGHTSPVESVR PA
0
71-88 (18) LNTPEELIVAGSQSGSIR PA
0
89-96 (8) VWDLEAAK PA
0
106-130 (25) ANICSLDFHPYGEFVASGSQDTNIK PA
0
161-172 (12) WLASAADDHTVK PA
0
173-180 (8) LWDLTAGK PA
0
181-211 (31) MMSEFPGHTGPVNVVEFHPNEYLLASGSSDR PA
0
221-235 (15) FQVVSCIEGEPGPVR PA
0
236-255 (20) SVLFNPDGCCLYSGCQDSLR PA
0
256-263 (8) VYGWEPER PA
0
264-274 (11) CFDVVLVNWGK PA
0
275-304 (30) VADLAICNDQLIGVAFSQSNVSSYVVDLTR PA
0
314-334 (21) DPVQDHRPLAQPLPNPSAPLR PA
0
336-349 (14) IYERPSTTCSKPQR PA
0
360-367 (8) SPSSEDDR PA
0
374-389 (16) AEIQNAEDYNEIFQPK PA
0
400-415 (16) SEPFPAPPEDDAATAK PA
0
416-449 (34) EAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPK PA
0
450-459 (10) AEPAIIPATR PA
0
467-475 (9) ASDFLPAVK PA
0
476-492 (17) IPQQAELVDEDAMSQIR PA
0
494-505 (12) GHDTMCVVLTSR PA
0
514-522 (9) AVWTMGDIK PA
0
523-547 (25) TSVDSAVAINDLSVVVDLLNIVNQK PA
0
553-565 (13) LDLCTTVLPQIEK PA
0
571-583 (13) YESYVQTGCTSLK PA
0
589-609 (21) FLPLITDMLAAPPSVGVDISR PA
0
646-655 (10) ELHLLMASLD PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center