Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9BVG8-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-17 (11) TWNLGATPSLR PA
3
25-54 (30) APEPEPGMARPAPAPASPAARPFPHTGPGR PA
3
62-74 (13) DTPVCGDEDSSAR PA
3
75-85 (11) SAARPALAQCR PA
3
86-110 (25) ALSVDWAGPGSPHGLYLTLQVEHLK PA
3
113-122 (10) LISQAQEVSR PA
3
125-134 (10) SELGGTDLEK PA
3
137-145 (9) DLLMVENER PA
3
153-161 (9) CEAELQELR PA
4
162-181 (20) TKPAGPCPGCEHSQESAQLR PA
4
184-195 (12) LSQLQLEMAESK PA
4
196-208 (13) GMLSELNLEVQQK PA
4
239-248 (10) DSHETIASLR PA
4
260-267 (8) TVEVESSK PA
4
270-278 (9) QALSESQAR PA
4
279-290 (12) NQHLQEQVAMQR PA
4
295-309 (15) EMEQQLQSSHQLTAR PA
4
312-323 (12) AQIAMYESELER PA
4
324-339 (16) AHGQMLEEMQSLEEDK PA
4
342-349 (8) AIEEAFAR PA
4
356-365 (10) AVHENLAGVR PA
4
366-376 (11) TNLLTLQPALR PA
4
377-386 (10) TLTNDYNGLK PA
4
391-401 (11) GFPLLLQEALR PA
4
405-423 (19) AEIGQAIEEVNSNNQELLR PA
4
458-484 (27) EDGEGPEATNAVTFDADDDSIIHLLHK PA
4
485-494 (10) GKPVSFELDK PA
4
495-534 (40) VFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGK PA
4
535-550 (16) TYTMEGTAENPGINQR PA
4
551-562 (12) ALQLLFSEVQEK PA
4
563-583 (21) ASDWEYTITVSAAEIYNEVLR PA
4
598-624 (27) LCPDGSGQLYVPGLTEFQVQSVDDINK PA
4
629-637 (9) EPLTTATLL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center